PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG111500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 740aa    MW: 81392 Da    PI: 6.4597
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG111500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-1970121556
                          SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +f+++q++eLe+ F+ + +p+ ++r+eL +k+gL+e+qV++WFqNrR  +k
  Pavir.7KG111500.1.p  70 KRFSAHQVQELEAKFQVCTHPDPRARQELGRKVGLEECQVRFWFQNRRSSMK 121
                          47**********************************************9988 PP

2START108.41.1e-342234473205
                          HHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S..... CS
                START   3 aeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla..... 77 
                          ae+a++e+v +a+ ++p+W+     + +  ++q+ +   +          + +ea r++ +  +++++lv++l d++ qW+e+++     
  Pavir.7KG111500.1.p 223 AERALKEFVMLATKGQPMWMPTI--DGEVLSVQEYDFHTFpgllglcprgFIVEATRETDMIKGDAVDLVSILTDVA-QWSEMFPdivay 309
                          7899****************999..44444444443333467889999999**************************.*******99987 PP

                          ..EEEEEEEECTT....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEE CS
                START  78 ..kaetlevissg....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepk 157
                            + ++++  s+     g +qlm  e+ + sp  p R++ f+R+++   + +w++vdvSvd ++  ++     s++  +llpSg+lie +
  Pavir.7KG111500.1.p 310 vrSTDVIASSSTSssrdGLIQLMDVEFWVQSPRLPsRNVKFLRFSKMIAERKWAVVDVSVDGNNGDEKeisGTSYAGYRLLPSGCLIENL 399
                          77666666666669999********************************************999988888989999999*********** PP

                          CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          s+g +kvtwv h ++ ++++++l+r++ +sg+a ga +w++ lqrqce
  Pavir.7KG111500.1.p 400 SGGFCKVTWVVHGEYLEATVPELFRQFFRSGQAYGACRWLRSLQRQCE 447
                          ***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1845121IPR009057Homeodomain-like
SuperFamilySSF466891.46E-1650121IPR009057Homeodomain-like
PROSITE profilePS5007115.90463123IPR001356Homeobox domain
SMARTSM003895.4E-1864127IPR001356Homeobox domain
CDDcd000863.14E-1665123No hitNo description
PfamPF000465.1E-1769121IPR001356Homeobox domain
PROSITE profilePS5084831.562212451IPR002913START domain
CDDcd088758.50E-74216447No hitNo description
SuperFamilySSF559611.13E-16218447No hitNo description
SMARTSM002343.3E-8221448IPR002913START domain
PfamPF018522.1E-28223447IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MENEDQLNNN NEQGLGLTMG SHAAWNQPVE YDLDDLLGAE DHHVDTSSHK SDDDEDRRPD  60
RGTPPSKRTK RFSAHQVQEL EAKFQVCTHP DPRARQELGR KVGLEECQVR FWFQNRRSSM  120
KLKACGNEIR DMQQENTKLR AENVELKQLI QNPTCFRCRD PSGADQLASE KRRLLSENAR  180
LKDELLRAKA YQDSNTREAE RPDQSMPLTY NCRTNKAALV SHAERALKEF VMLATKGQPM  240
WMPTIDGEVL SVQEYDFHTF PGLLGLCPRG FIVEATRETD MIKGDAVDLV SILTDVAQWS  300
EMFPDIVAYV RSTDVIASSS TSSSRDGLIQ LMDVEFWVQS PRLPSRNVKF LRFSKMIAER  360
KWAVVDVSVD GNNGDEKEIS GTSYAGYRLL PSGCLIENLS GGFCKVTWVV HGEYLEATVP  420
ELFRQFFRSG QAYGACRWLR SLQRQCEYMA VLGSSHVPSS SSSSGAAISP LGKRGVLELA  480
LRMKETFYAA VSGPVTMAST NVVDQWCVSS GTGAERVDAA VRMVTWNCAE IMPREPAITV  540
LSATTTVRLP GTPPQRVFEY ICNLQRRGEW DKFVNGVLVE EVSYVPTSAR LHGNSVSILR  600
PTVVADGSHG RNSNVLILQH SSTDASGSLV VYSLVEEKVM RGIMGGADNS IFLMPSGFAI  660
LPDGHGCKAR CTAARSCSSA PIGHSNGEGA LLTVASLGML PSSPSGGVAA RSFDDAGEQL  720
CNTIRKIRDA VGANSVIMS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669630.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
TrEMBLK3YDL50.0K3YDL5_SETIT; Uncharacterized protein
STRINGSi012320m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-110HD-ZIP family protein